BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0049 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8782| Best HMM Match : CN_hydrolase (HMM E-Value=0) 40 0.003 SB_11184| Best HMM Match : CN_hydrolase (HMM E-Value=4.4e-10) 39 0.005 SB_43069| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_47367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_8338| Best HMM Match : PA (HMM E-Value=5.7e-10) 29 3.0 SB_8320| Best HMM Match : p450 (HMM E-Value=0) 29 3.0 SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) 29 4.0 SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) 28 7.0 SB_19326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 28 7.0 SB_17868| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.7e-36) 28 9.2 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 28 9.2 SB_9767| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_8782| Best HMM Match : CN_hydrolase (HMM E-Value=0) Length = 242 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +1 Query: 514 VIVSSILERDEKHSDILWNTAVVISDTGNVIGKHRKNH-----IPRVGDFNESNYYMEGN 678 ++ SI ER L+NT++ +GN++GKHRK H +P F ES G Sbjct: 82 IVGGSIPERASNRK--LYNTSLSYDPSGNLMGKHRKIHLFDIDVPGKIRFQESEVLSPGE 139 Query: 679 TGHPVFATRYGKIAVNICF 735 + T Y KI + IC+ Sbjct: 140 -NLTILDTEYCKIGIGICY 157 >SB_11184| Best HMM Match : CN_hydrolase (HMM E-Value=4.4e-10) Length = 128 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +1 Query: 514 VIVSSILERDEKHSDILWNTAVVISDTGNVIGKHRKNH-----IPRVGDFNESNYYMEGN 678 ++ SI ER L+NT++ +GN++GKHRK H +P F ES G Sbjct: 38 IVGGSIPERASNGK--LYNTSLSYDPSGNLMGKHRKIHLFDIDVPGKIRFQESEVLSPGE 95 Query: 679 TGHPVFATRYGKIAVNICF 735 + T Y KI + IC+ Sbjct: 96 -NLTILDTEYCKIGIGICY 113 >SB_43069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -2 Query: 736 RSRCSPRSCRIWSQIQDGRCYLPCSSW-----IR*NRRLSEC-GSCDVSRSRFR 593 R RC+P++C++ + RC L C + R R +C G CD++ + R Sbjct: 29 RRRCNPQNCQVGQWVPWSRCNLACGDYGTQRRTRSKTRSEKCGGKCDLALIQVR 82 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +1 Query: 154 KNPRSLQLRRLTSTSPHTLSRPRTSRPDPREL*SRNSSAFHRGAHRSSSQRAKE 315 K PR R S+SP SRP+ + P PR + RG+ RS S +E Sbjct: 1047 KRPRHQSRERRPSSSPPRRSRPQRTSPSPRR--TPEDRRRSRGSRRSPSPPKRE 1098 >SB_47367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 157 NPRSLQLRRLTSTSPHTLSRPRTSRPDP 240 +PR + L+ S+SPHT R R+S DP Sbjct: 687 SPRHVLLQEARSSSPHTSIRNRSSSSDP 714 >SB_33872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +1 Query: 568 NTAVVISDTGNVIGK---HRKNHIPRVGDFNE----SNYYMEGN-TGHPVFATRYGKI 717 NTA +IS+TG+VI K H K + P D + Y GN TG PV+A YG++ Sbjct: 52 NTAKIISNTGDVIYKTRTHEKVYEPSEKDPSAIPPFLAYSPSGNVTGDPVYA-NYGRV 108 >SB_8338| Best HMM Match : PA (HMM E-Value=5.7e-10) Length = 326 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 8/58 (13%) Frame = +1 Query: 568 NTAVVISDTGNVIGK---HRKNHIPRVGDFNE----SNYYMEGN-TGHPVFATRYGKI 717 NTA +IS+TG+VI K H K + P D + Y GN TG PV+A YG++ Sbjct: 143 NTAKIISNTGDVIYKTRTHEKVYEPSEKDPSAIPPFLAYSPSGNVTGDPVYA-NYGRV 199 >SB_8320| Best HMM Match : p450 (HMM E-Value=0) Length = 1207 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -2 Query: 553 NASRPFLISRTRSPLVLDGEFPKEGRGRPVFS*FGKLAPRLLLPC 419 N+++ F + RS + DGE K GR FS KLA +L C Sbjct: 382 NSAKSFTRNGARSIVRADGEERKFGRSEEEFSDLDKLAINILYDC 426 >SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -2 Query: 406 GHVPQLLETDDVNTLLAGNIDDFLDFIENCFLLLVDW 296 G VP + +NTLL GN D F NC LL W Sbjct: 723 GLVPYWTKLFGINTLLVGNARDSHLFCRNCSGLLPYW 759 >SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) Length = 1425 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +2 Query: 239 PENCEVGIVQHSIAVPTDR-PVNEQKKAIFNKVKKIIDVAGQEGVN 373 P N V I VP + P N+ ++A+F++V K+ ++ GQ+ V+ Sbjct: 971 PNNPSEEFVHKPILVPVMKSPRNDDERALFSRVSKVKNLWGQDLVD 1016 >SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) Length = 700 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 544 EKHSDILWNTAVVISDTGNVIGKHRKNHIPRVGDFNESNYYME 672 +K D LW A + D KH++N I R +F E ++Y E Sbjct: 391 QKRFDTLWVKAKSMMDEET---KHKENAIKRSKEFEERSHYFE 430 >SB_19326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 514 VIVSSILERDEKHSDILWNTAVVISDTGNVIGKHRK 621 ++ SI ER L+NT++ +GN++GKHRK Sbjct: 84 IVGGSIPERASNGK--LYNTSLSYDPSGNLMGKHRK 117 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +2 Query: 245 NCEVGIVQHSIAVPTDRPVNEQKKAIFNKVKKIIDVAGQEGVNIICFQELW 397 N ++ + H VP+ N + A K+ ++ VA Q +++C E W Sbjct: 112 NSDISSINHPAVVPSLLVSNTRSLA--PKISELQCVASQNSADVVCITETW 160 >SB_17868| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.7e-36) Length = 592 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 142 KSN*KNPRSLQLRRLTSTSPHTLSRPRTSRPDPREL*SRNSSAFHRGAHRSSSQRA 309 ++N K P+ L+ L TS L + DPR S N +A R H+S +Q A Sbjct: 393 RTNRKMPQWLRTLILNWTSRVVLLHDVVVKTDPRRQMSFNPAAKRRTMHKSDNQSA 448 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 577 VVISDTGNVIGKHRKNHIPRVGDFNESNYYMEGNTGHPVFATRYGKIAVNI 729 + +S T + G+H + R +ES Y++ GH FAT+ + + I Sbjct: 490 LTVSYTPRIHGEHEITILARGQHVDESPYHVHVKKGHMNFATKNTPVCLRI 540 >SB_9767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +1 Query: 142 KSN*KNPRSLQLRRLTSTSPH---TLSRPRTSRPDPREL*SRNSSAFHRGAHRSSSQRAK 312 K+N K + Q + + P+ TL R + P PRE S + F G HRS + Sbjct: 4 KNNKKKKQEKQNKTKKTDHPNNRLTLGRGVLTGPPPREFFSGSPDQFRNGIHRSMEMDLE 63 Query: 313 ESN 321 +++ Sbjct: 64 DTS 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,713,144 Number of Sequences: 59808 Number of extensions: 540892 Number of successful extensions: 1588 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -