BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0048 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.15 |rpb5||DNA-directed RNA polymerase I, II and III sub... 25 5.6 SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase |Schiz... 25 7.4 >SPAC23C4.15 |rpb5||DNA-directed RNA polymerase I, II and III subunit Rpb5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 25.4 bits (53), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 374 LSFFC*TSTDSNKGSAYV 321 LSF+ S DSNKG+ Y+ Sbjct: 57 LSFYAKPSNDSNKGTIYI 74 >SPBPB2B2.10c |||galactose-1-phosphate uridylyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 369 Score = 25.0 bits (52), Expect = 7.4 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 303 SHRRYGHIRGSFIRVSRRSAEKR-QIP*EEGRSEGTVRERSEERLLPGQV 449 SHRRY + S++ S A++ Q EE + + TV+ L PG + Sbjct: 12 SHRRYNPLTDSYVLCSPHRAKRPWQGAKEEIKKDDTVKYDPTCYLCPGNI 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,732,225 Number of Sequences: 5004 Number of extensions: 25701 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -