BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0045 (538 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0254 - 1938343-1938447,1938545-1938700,1939209-1939472,193... 28 4.1 05_06_0212 + 26410330-26410419,26410562-26410846,26411005-264112... 27 7.2 >05_01_0254 - 1938343-1938447,1938545-1938700,1939209-1939472, 1939563-1939777,1939863-1940672,1941758-1942388 Length = 726 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -2 Query: 441 NENLSCPIQNSGINNVVYQQLIESKDKARRKSTQVTSRVKRGK 313 N+ LS I +S + + L E KDK + K+ + TSRV + K Sbjct: 271 NDMLSSCISDSIVKQLEDVVLEEKKDKKKNKAAKGTSRVGKSK 313 >05_06_0212 + 26410330-26410419,26410562-26410846,26411005-26411208, 26411636-26411692,26411859-26412926 Length = 567 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 1 ARVAGRLLRGSHSRIQTNYKLKPTKEGQG-RFLWK 102 A V GR +R S + IQ N+KL + G G R WK Sbjct: 167 ALVRGRNVRLSTNTIQVNWKLVQQQSGSGKRDAWK 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,873,999 Number of Sequences: 37544 Number of extensions: 229324 Number of successful extensions: 379 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -