BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0045 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 1.2 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 25 2.1 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 6.5 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 23 6.5 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.4 bits (53), Expect = 1.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +1 Query: 430 QIFVDNIGLQNNTICIQNWQGVKSQ*H 510 + F+++IG+Q NT C + ++ S+ H Sbjct: 157 ETFINSIGIQCNTTCPEGFEAQLSEQH 183 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -3 Query: 455 NPILSTKICHVRSRTPGSIMLFINNLSSLKIKHAEN 348 NP L+ K C V ++ ML++N + + +K+ ++ Sbjct: 335 NPTLAPKACCVPTQLSSISMLYLNEQNKVVLKNYQD 370 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 290 RNLARQGAYCNMTVFFAC 237 + L +QGA CN+ F C Sbjct: 1339 QQLLQQGAACNVLYLFTC 1356 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 425 HDRFSLIILDYKTTQYVFKIGRE*NPNSTFLLNNK 529 H R L++L +K +Y+ +PN+ L++NK Sbjct: 28 HGRNVLLLLFHKHPRYIAYFDFTDDPNAQSLVDNK 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,790 Number of Sequences: 2352 Number of extensions: 9867 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -