BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0045 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060790-1|AAL28338.1| 315|Drosophila melanogaster GH26007p pro... 29 4.0 AE014296-646|AAF47763.3| 315|Drosophila melanogaster CG14969-PA... 29 4.0 >AY060790-1|AAL28338.1| 315|Drosophila melanogaster GH26007p protein. Length = 315 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +2 Query: 227 KINYTQKTLSCCNRHLVLPSCVI*YCTIV-LPLFTLDVT 340 ++N++ KTL CC R + L + +I +V LP+FT +T Sbjct: 178 RLNWS-KTLKCCQREVKLTNFLIAVGVVVLLPIFTFYIT 215 >AE014296-646|AAF47763.3| 315|Drosophila melanogaster CG14969-PA protein. Length = 315 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +2 Query: 227 KINYTQKTLSCCNRHLVLPSCVI*YCTIV-LPLFTLDVT 340 ++N++ KTL CC R + L + +I +V LP+FT +T Sbjct: 178 RLNWS-KTLKCCQREVKLTNFLIAVGVVVLLPIFTFYIT 215 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,390,861 Number of Sequences: 53049 Number of extensions: 414575 Number of successful extensions: 686 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -