BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0040 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 27 2.0 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 27 2.0 SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 3.5 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 143 RLIRDVIDVRSAPNYNCV*NLS*QYITCNVVST 241 RLI + +AP Y V S +++TC +VS+ Sbjct: 35 RLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSS 67 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 143 RLIRDVIDVRSAPNYNCV*NLS*QYITCNVVST 241 RLI + +AP Y V S +++TC +VS+ Sbjct: 35 RLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSS 67 >SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 615 Score = 26.2 bits (55), Expect = 3.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 320 TYFILEGGCCSIFFFEFLAWYL 385 +YF+L+G IF+F +L +++ Sbjct: 236 SYFLLDGSSSKIFYFNWLGFFV 257 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,917,392 Number of Sequences: 5004 Number of extensions: 32634 Number of successful extensions: 58 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -