BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0040 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0102 - 735359-735370,735371-735455,735531-735616,735697-73... 30 1.2 07_01_0700 + 5280650-5281757,5282509-5282519,5282872-5282967 28 4.7 >08_01_0102 - 735359-735370,735371-735455,735531-735616,735697-735779, 736790-737048,737132-737300,738554-738698,738782-739004 Length = 353 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 158 VIDVRSAPNYNCV*NLS*QYITCNVVSTPGYLCNVIISFLFSEL*IYLFFFCFSTYFILE 337 V+ + P C+ Q + S G C IS L S L +F+FCF T+F++E Sbjct: 118 VVSDKLGPRQACIFYWMLQLAVGALKSFSGLRC-AWISNLISALASSMFYFCFETWFVVE 176 >07_01_0700 + 5280650-5281757,5282509-5282519,5282872-5282967 Length = 404 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +2 Query: 242 PGYL-CNVIISFLFSEL*IYLFFFCFSTYFILEGGCCSIFFFEFLAWYLDL 391 PGYL N +F ++ +CFS LE GC F F W + L Sbjct: 195 PGYLGWNCTNGVVFKGAAYFILDYCFSDPSFLERGCMPSFDFATEKWSVAL 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,461,728 Number of Sequences: 37544 Number of extensions: 184373 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -