BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0040 (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 5.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 5.4 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.4 bits (48), Expect = 5.4 Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 227 NVVSTPGYLCNVIISFLFS-EL*IYLFFFCFSTYFILEGGCCSIFFFEFLAWYLDL*AIR 403 NV+S GY C+V+ + L F F+ ++ I + WYL+ IR Sbjct: 80 NVISLAGYFCDVVFDVVLGYALYERQKFAYFAAVIVIVSFSLVISQIVSIRWYLNKRKIR 139 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 279 NRNEIITLHRYPGVDTTLQVMYC 211 +RN+ TLH + V +++YC Sbjct: 418 DRNQPATLHHHQQVHNQQRILYC 440 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 487,384 Number of Sequences: 2352 Number of extensions: 8433 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -