BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0040 (579 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 3.8 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 6.7 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 6.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 6.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 6.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 6.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 8.8 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.8 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 8.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 8.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 8.8 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 3.8 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 563 YLKITY*HNHLKKKSFNITTPTN*LPCGGLSL*RTLIYGTRTKHGHTTLLSILI 402 YL IT+ N ++ T +PC G+S L++ + G LSI I Sbjct: 227 YLDITF--NITMRRKTLFYTVNLIIPCMGISFLTVLVFYLPSDSGEKVSLSISI 278 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 14 KKDRQYEKLHNEKEKFL 30 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 14 KKDRRYDQLHN 24 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 262 KKDRRYDQLHN 272 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 247 KKDRQYEKLHNEKEKFL 263 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 247 KKDRQYEKLHNEKEKFL 263 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 129 KKDREYDIRHNARLIYL 79 KKDR+Y+ HN + +L Sbjct: 247 KKDRQYEKLHNEKEKFL 263 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 129 KKDREYDIRHN 97 KKDR YD HN Sbjct: 263 KKDRRYDQLHN 273 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 14 KKDRQYEKLHNEK 26 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 491 LPCGGLSL*RTLIYGTRTKHGHTTLLSILI 402 +PC G+S L++ + G LSI I Sbjct: 245 IPCVGISFLSVLVFYLPSDSGEKVSLSISI 274 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 247 KKDRQYEKLHNEK 259 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 236 KKDRQYEKLHNEK 248 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 247 KKDRQYEKLHNEK 259 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 236 KKDRQYEKLHNEK 248 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 247 KKDRQYEKLHNEK 259 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 247 KKDRQYEKLHNEK 259 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 236 KKDRQYEKLHNEK 248 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 129 KKDREYDIRHNAR 91 KKDR+Y+ HN + Sbjct: 236 KKDRQYEKLHNEK 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,449 Number of Sequences: 438 Number of extensions: 2626 Number of successful extensions: 45 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -