BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0038 (405 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 0.75 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 3.0 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 4.0 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.8 bits (49), Expect = 0.75 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 402 SCSRALASVSEPSHTCTCSGWHRAACAP 319 +CS +AS++E H SG H A+ AP Sbjct: 499 TCSGEVASLTEYHHVAPPSG-HHASSAP 525 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.8 bits (44), Expect = 3.0 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 273 PSPQLTTLTPKVRAFVERRLLCASRSTCTCATA 371 PSP+ T+TP+ + + + L T + A Sbjct: 132 PSPEWDTVTPEAKNLINQMLTVNPSKRITASEA 164 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 292 VVSCGEGFVD 263 +V+CG GF+D Sbjct: 208 IVACGAGFID 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,125 Number of Sequences: 438 Number of extensions: 1569 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -