BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0033 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0795 + 25287449-25287967,25288078-25288138,25288640-252887... 28 6.1 08_02_0167 - 13564466-13566227,13566361-13566644,13566684-135675... 28 8.1 >01_05_0795 + 25287449-25287967,25288078-25288138,25288640-25288734, 25288827-25288939,25289480-25289648,25289777-25289816, 25289906-25289970,25290150-25290263,25290398-25290462, 25290572-25290725,25290798-25290914,25292489-25292545 Length = 522 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 540 ELDYLTQFCNYF*SPIAKFKICKHIIQHIP 629 +L+Y Q C SP+ + C+H I H+P Sbjct: 459 KLEYANQLCGNMPSPVGSYVDCRH-IGHLP 487 >08_02_0167 - 13564466-13566227,13566361-13566644,13566684-13567540, 13567684-13567957,13567973-13568218 Length = 1140 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 410 ETI*AIATEKSPKSFTQIKTIINLQYFFYR 499 ET+ A+ K PKS TQ+++ + L ++ R Sbjct: 487 ETVTAVTDLKQPKSVTQVRSFLGLAGYYRR 516 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,274,279 Number of Sequences: 37544 Number of extensions: 176567 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -