BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0033 (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 25 0.52 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 25 0.52 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.8 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 170 NFETHIYSYNNTTKTKEFLKVSYK 99 N E +I SY N KEFL + YK Sbjct: 65 NIEANIDSYTNAAAVKEFLSI-YK 87 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 170 NFETHIYSYNNTTKTKEFLKVSYK 99 N E +I SY N KEFL + YK Sbjct: 65 NIEANIDSYTNAAAVKEFLSI-YK 87 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 121 SFLK*VTKYLYSEHVLTEVLQIYFRMKIIIYRKS 20 SFL+ V Y + V E+L+ + MK+I S Sbjct: 143 SFLRTVPPYSHQTDVWVELLKHFNYMKVIFIHSS 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,572 Number of Sequences: 438 Number of extensions: 2727 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -