BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0031 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pomb... 28 1.5 SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces po... 27 3.4 >SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 394 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 121 RATSPVVPLSPTRTISSVFANGADTSAAIFGSASRTRAI 5 R T V+P P ++S+ ANG+ S+ I +A + +++ Sbjct: 57 RVTFAVLPTKPKDEVTSMKANGSRQSSCIVSNARKRQSV 95 >SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 26.6 bits (56), Expect = 3.4 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 45 EVSAPLAKTDEIVLVGDNGTTGDVARL--ASGIPPALKTLTG 164 E+S K D I+ VG +GT A L SG+PP L G Sbjct: 117 EISDLEQKVDAIITVGGDGTILHAASLFARSGMPPILSFSLG 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,599,517 Number of Sequences: 5004 Number of extensions: 51376 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -