BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0029 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 25 0.49 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 4.5 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 6.0 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 25.4 bits (53), Expect = 0.49 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 110 TVNNVRSNGSGEEEIRWKRRVGARRYHLTSLYARRFATG 226 TV+ V SN G + IR+K+ +G + +LYA + A G Sbjct: 273 TVSQV-SNWFGNKRIRYKKNIG-KAQEEANLYAAKKAAG 309 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 279 FASIKMLLKIKHKKSNILQSKRLLCER 359 F +I L + H K +I + KRL C + Sbjct: 209 FVAITKLEQWNHSKVHIREDKRLTCPK 235 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.2 bits (45), Expect = 4.5 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +2 Query: 125 RSNGSGEEEIRWKRRVGARRYHLTSLYARRFATGGRTRENPTRSNKELETAL 280 R++G+G + R A++ + ++ + A GGR P RS + L L Sbjct: 295 RADGAGGP-LHDHRPALAQQRRVAAVQVPQLAGGGRRGPGPARSRRHLPAHL 345 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +2 Query: 428 HRLAVDHAADKKHIKSLCSNIDTVE 502 H L + + + +K+ CS++D+V+ Sbjct: 260 HHLVNPQSLNHQEVKAECSDLDSVD 284 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,502 Number of Sequences: 336 Number of extensions: 2642 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -