BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0029 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 25 0.99 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 25 0.99 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 5.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 5.3 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 24.6 bits (51), Expect = 0.99 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 331 KIFDFLCLIFNNILMLAKGCLEFLVASSRVFP 236 +IF+ +C++ ++ GCL+FLV + FP Sbjct: 278 RIFNLICMML--LIGHWSGCLQFLVPMLQGFP 307 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 24.6 bits (51), Expect = 0.99 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 331 KIFDFLCLIFNNILMLAKGCLEFLVASSRVFP 236 +IF+ +C++ ++ GCL+FLV + FP Sbjct: 246 RIFNLICMML--LIGHWSGCLQFLVPMLQGFP 275 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 425 NHRLAVDHAADKKHIKSLCSNID 493 NH + A K ++KSL SN D Sbjct: 249 NHEKMLREQAKKMNVKSLVSNQD 271 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 425 NHRLAVDHAADKKHIKSLCSNID 493 NH + A K ++KSL SN D Sbjct: 249 NHEKMLREQAKKMNVKSLVSNQD 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,003 Number of Sequences: 438 Number of extensions: 2993 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -