BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0028 (703 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 25 0.79 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 25 0.79 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 24.6 bits (51), Expect = 0.79 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +3 Query: 276 ICVIKYIKGLFVLPITILWVINIPLTVITLQF*LYKITNYSIGTFDIYAI*LKVRLIF 449 IC++K +G+ ++ W I +T TLQ +Y +G DIY I + +IF Sbjct: 211 ICLLK--EGVDLVNDIFGWQILFLITYATLQILVYLHLAVMLGFQDIYMIVYIIVVIF 266 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 24.6 bits (51), Expect = 0.79 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +3 Query: 276 ICVIKYIKGLFVLPITILWVINIPLTVITLQF*LYKITNYSIGTFDIYAI*LKVRLIF 449 IC++K +G+ ++ W I +T TLQ +Y +G DIY I + +IF Sbjct: 211 ICLLK--EGVDLVNDIFGWQILFLITYATLQILVYLHLAVMLGFQDIYMIVYIIVVIF 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,235 Number of Sequences: 336 Number of extensions: 4603 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -