BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0028 (703 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1619 + 28174991-28175804,28175945-28175968,28176075-281761... 28 8.3 02_02_0372 + 9522751-9522964,9523043-9523255,9523471-9523555,952... 28 8.3 >07_03_1619 + 28174991-28175804,28175945-28175968,28176075-28176170, 28176285-28176466,28176623-28176836,28177262-28177499, 28177709-28177865,28177950-28178246 Length = 673 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = -2 Query: 321 LSGAQKDLLYILLHKYVCIIICGIRDAVSFYDKQLSLRIFEFG 193 + G + LLY+ H VC++ ++ + D +++ +I +FG Sbjct: 460 IHGISQGLLYLHEHSTVCVVHRDLKASNVLLDAEMNAKISDFG 502 >02_02_0372 + 9522751-9522964,9523043-9523255,9523471-9523555, 9524373-9524448,9524974-9525150,9525473-9525566, 9526357-9526466,9526568-9526657,9526752-9526832, 9528468-9529277,9530777-9530896 Length = 689 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = -2 Query: 303 DLLYILLHKYVC-IIICGIR 247 DL Y++LH+YV +IICG++ Sbjct: 260 DLSYLVLHRYVKEVIICGLK 279 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,491,200 Number of Sequences: 37544 Number of extensions: 372268 Number of successful extensions: 686 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -