BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0028 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 24 1.2 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 4.9 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.6 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 239 YHFMINNYH*EYLNLVDMFFSLSGDMMQELCEAH*AHSLKPKRTENSFTRQLL 81 Y F+ +H + + L D +F + GD L H A + T N R+ L Sbjct: 130 YEFLNAIHHYDDIWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHL 182 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 239 YHFMINNYH*EYLNLVDMFFSLSGDMMQELCEAH*AHSLKPKRTENSFTRQLL 81 Y F+ +H + + L D +F + GD L H A + T N R+ L Sbjct: 130 YEFLNAIHHYDDIWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHL 182 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 239 YHFMINNYH*EYLNLVDMFFSLSGDMMQELCEAH*AHSLKPKRTENSFTRQLL 81 Y F+ +H + + L D +F + GD L H A + T N R+ L Sbjct: 181 YEFLNAIHHYDDIWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHL 233 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 239 YHFMINNYH*EYLNLVDMFFSLSGDMMQELCEAH*AHSLKPKRTENSFTRQLL 81 Y F+ +H + + L D +F + GD L H A + T N R+ L Sbjct: 130 YEFLNAIHHYDDIWLPDTYFIMHGDFKDPLIPVHFALRIYRNGTVNYLMRRHL 182 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -1 Query: 322 VIGSTKRPFIYFITQICMY 266 ++ +TK+ FIY + +C++ Sbjct: 1 MVSNTKQAFIYSLALLCLH 19 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 514 FTRMAVVLGARPHKCFTY 567 F R + A PHK FTY Sbjct: 598 FRRQERMRYAAPHKAFTY 615 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,523 Number of Sequences: 438 Number of extensions: 5860 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -