BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0026 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.1 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 6.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 405 LNSDKGLFQSVERARVQHLLLNLGGVRAP 319 L+ K + Q V R + H LN+ VR+P Sbjct: 335 LDEKKYILQEVVRVKKPHYELNMVEVRSP 363 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/43 (20%), Positives = 17/43 (39%) Frame = +2 Query: 56 TVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAE 184 T+S CK + H+ V F +++ ++ G E Sbjct: 31 TISQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSLTE 73 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 465 PRHRSPINSIYTRARTKPNPLS 530 P H+ P N + T NPLS Sbjct: 741 PHHQPPRNPVGTNPHDINNPLS 762 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 465 PRHRSPINSIYTRARTKPNPLS 530 P H+ P N + T NPLS Sbjct: 633 PHHQPPRNPVGTNPHDINNPLS 654 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,814 Number of Sequences: 336 Number of extensions: 2699 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -