BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0025 (664 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117754-1|AAD22032.1| 2174|Homo sapiens thyroid hormone recepto... 30 6.4 AB011165-1|BAA25519.2| 2005|Homo sapiens KIAA0593 protein protein. 30 6.4 >AF117754-1|AAD22032.1| 2174|Homo sapiens thyroid hormone receptor-associated protein complex component TRAP240 protein. Length = 2174 Score = 30.3 bits (65), Expect = 6.4 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +3 Query: 381 QLLYMLTKPYCRVCGCSVSLAPAALDAC----RPSPTYVSRSAPDSLHSLYTKSVTI 539 Q L K CR+CG S + +P+ L AC P ++V S S++ +S T+ Sbjct: 1886 QSLSKRLKDMCRMCGISAADSPSILSACLVAMEPQGSFVIMPDSVSTGSVFGRSTTL 1942 >AB011165-1|BAA25519.2| 2005|Homo sapiens KIAA0593 protein protein. Length = 2005 Score = 30.3 bits (65), Expect = 6.4 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +3 Query: 381 QLLYMLTKPYCRVCGCSVSLAPAALDAC----RPSPTYVSRSAPDSLHSLYTKSVTI 539 Q L K CR+CG S + +P+ L AC P ++V S S++ +S T+ Sbjct: 1717 QSLSKRLKDMCRMCGISAADSPSILSACLVAMEPQGSFVIMPDSVSTGSVFGRSTTL 1773 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,213,007 Number of Sequences: 237096 Number of extensions: 1835222 Number of successful extensions: 3722 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3722 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -