BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0024 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0226 - 1654917-1656923,1658757-1658810,1659128-1660891 28 8.8 04_04_0419 + 25086456-25086768,25087302-25087369,25087458-250876... 28 8.8 02_04_0012 - 18891917-18893091,18893209-18893323,18893425-188934... 28 8.8 >07_01_0226 - 1654917-1656923,1658757-1658810,1659128-1660891 Length = 1274 Score = 27.9 bits (59), Expect = 8.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 233 IIDFVFHCSHKTLLNDILD 289 ++D+V HC H+ LND +D Sbjct: 1157 LVDWVLHCWHQGFLNDAVD 1175 >04_04_0419 + 25086456-25086768,25087302-25087369,25087458-25087681, 25087929-25088012,25088593-25088806,25089252-25089428, 25089526-25089645,25089865-25089991,25090104-25090130, 25090526-25091007 Length = 611 Score = 27.9 bits (59), Expect = 8.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -1 Query: 148 VFYYRLNGWTSSRPTGVKWLPE 83 +F Y+ NGW + TG+++LP+ Sbjct: 564 LFCYKANGWNAWLVTGIQFLPQ 585 >02_04_0012 - 18891917-18893091,18893209-18893323,18893425-18893477, 18893553-18893813,18896451-18896501,18896629-18896877, 18897046-18897268,18897371-18897487 Length = 747 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 177 IIKAGNVTFGQLLVNQKNELLTLYSIAVTKLF*TTS*INNRLSI 308 ++ N GQ+ + + N L+ + S+A+T F TT+ I N I Sbjct: 400 VVHTSNKYEGQVYIPEVNFLIGVASVAITVAFQTTANIGNAYGI 443 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,649,350 Number of Sequences: 37544 Number of extensions: 334015 Number of successful extensions: 443 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -