BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0021 (611 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containi... 28 4.2 At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR... 27 7.4 At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutas... 27 7.4 >At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 903 Score = 28.3 bits (60), Expect = 4.2 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 22 HGYLTIWKLIIMSKIIKFDLRELKQLANDKNSCLVVKKI-TQNLALQPWCLGNIKESITN 198 H L + +I+ IK + E+ L ++ + I T N A+Q C G E TN Sbjct: 591 HKSLETYNSLILGLGIKNQIFEIHGLMDEMKEKGISPNICTYNTAIQYLCEGEKVEDATN 650 Query: 199 LLDYKVGK 222 LLD + K Sbjct: 651 LLDEMMQK 658 >At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1607 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 115 SCLVVKKITQNLALQPWCLGNIKE 186 S +V+ +++N AL PWCL + E Sbjct: 103 SRIVIVVLSRNYALSPWCLDELVE 126 >At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutase 2 (GSA 2) / glutamate-1-semialdehyde aminotransferase 2 (GSA-AT 2) identical to GSA2 [SP|Q42522] Length = 472 Score = 27.5 bits (58), Expect = 7.4 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -1 Query: 131 FTTKQEFLSFANCFNSRRSNFMI 63 FT KQ+F+ F C++ ++F++ Sbjct: 176 FTGKQKFIKFEGCYHGHANSFLV 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,791,982 Number of Sequences: 28952 Number of extensions: 221568 Number of successful extensions: 467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -