BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0017 (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 26 1.2 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 2.7 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 26.2 bits (55), Expect = 1.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 156 SARLAEERKAWRKDHPFGFVARPMKNPDGS 245 SA AE AWR+ P VA P P+G+ Sbjct: 41 SATSAELEIAWRESSPPTLVAGPYPEPNGT 70 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 341 YPSSPPKCKFEPPLFHPNVYPSGTVCLS 424 YPS P + F+P ++P P + S Sbjct: 178 YPSYPTEANFQPHPYYPKYEPDAYITAS 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 826,642 Number of Sequences: 2352 Number of extensions: 17019 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -