BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0016 (725 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 3.1 At1g22800.1 68414.m02848 expressed protein similar to Biotin syn... 29 4.1 At3g45210.1 68416.m04879 expressed protein contains Pfam profile... 28 7.2 At2g46710.1 68415.m05828 rac GTPase activating protein, putative... 28 7.2 At1g53230.1 68414.m06032 TCP family transcription factor 3 (TCP3... 28 7.2 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 27 9.6 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 242 SLHHSQHRSHKYRSSRGHHEHPDTVPP 322 ++H H K R HH+HP PP Sbjct: 64 AIHEKHHHRRKKWRQRRHHKHPPPPPP 90 >At1g22800.1 68414.m02848 expressed protein similar to Biotin synthesis protein bioC. {Serratia marcescens} (SP:P36571); ESTs gb|Z34075, gb|Z34835 and gb|AA404888 come from this gene Length = 355 Score = 28.7 bits (61), Expect = 4.1 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = +1 Query: 55 LILSTKMLFFITAAVLLASAEAKFFKDCGSKLATVHNVTVSGCEESSSHCILKRNTDATI 234 L+ K+L TA A ++ F + G+ AT + ++G E SSH KR AT+ Sbjct: 283 LLERNKILNRETAVATAAIYDSMFATEDGTIPATFQVIYMTGWREHSSHPQAKRRGSATV 342 Query: 235 GLQFTPL 255 FT L Sbjct: 343 --SFTDL 347 >At3g45210.1 68416.m04879 expressed protein contains Pfam profile PF04520: Protein of unknown function, DUF584 Length = 148 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 185 SHPLTVTLWTVASLDPQSLKNLASALAKSTAAVMKNN 75 S P TVT TVAS P +++N + L K ++N+ Sbjct: 60 SSPATVTTTTVASSLPMNVQNWSKILGKENRKSIEND 96 >At2g46710.1 68415.m05828 rac GTPase activating protein, putative similar to rac GTPase activating protein 2 [Lotus japonicus] GI:3695061; contains Pfam profiles PF00620: RhoGAP domain, PF00786: P21-Rho-binding domain Length = 455 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 355 SPLSLHASDSGRGNGIGMFMMTP*TSVFMRSML 257 +PLS HAS SG G+G G + + +R L Sbjct: 54 TPLSSHASRSGNGSGSGQLTVVDLLAAVLRKSL 86 >At1g53230.1 68414.m06032 TCP family transcription factor 3 (TCP3) identical to transcription factor 3 (TCP3) [Arabidopsis thaliana] (GI:3243274); similar to flower development protein cycloidea (cyc3) GI:6358611 from [Misopates orontium] Length = 391 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 Query: 248 HHSQHRSHKYRSSRGHHEHPDTVPP 322 HH H + HH HP +PP Sbjct: 318 HHHHHHQQSMTTDDLHHHHPYHIPP 342 >At5g65410.1 68418.m08226 zinc finger homeobox family protein / ZF-HD homeobox family protein similar to hypothetical proteins (GP|4220524)(GP|3184285|)(Arabidopsis); ZP-HD homeobox family protein GP|13374061 (Flaveria bidentis);GP:5091602 {Oryza sativa} Length = 279 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 212 RETQTPRSACS--LHHSQHRSHKYRSSRGHHEHPDTVPP 322 +ET PR LH+++H K S HH+ P PP Sbjct: 230 QETGVPRQVLKVWLHNNKHTLGKSPSPLHHHQAPPPPPP 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,066,112 Number of Sequences: 28952 Number of extensions: 309486 Number of successful extensions: 889 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -