BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0015 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 1.5 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 4.5 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 612 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 731 N++ R +EE ++M NE+ K + QK+ Q + S Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGS 243 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +3 Query: 558 NVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNE 683 N+ A++K KI TN++ ++++ ++ EK +NE Sbjct: 1024 NMKAMQKLDRVTEKIQSTNEEFEAARKKAKKAKAAFEKVKNE 1065 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,419 Number of Sequences: 2352 Number of extensions: 13984 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -