BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0012 (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 29 4.7 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = -1 Query: 680 KIRTPVHRYIRMQPDVLSFRPRRLNTHTTSLA 585 KIR P H Y R QP V + LN TTS+A Sbjct: 115 KIRKPHHHYSRHQPSVTTV---TLNADTTSIA 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,755,824 Number of Sequences: 28952 Number of extensions: 268868 Number of successful extensions: 441 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -