BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0011 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0511 - 16664923-16665509,16665600-16665902,16665954-16666218 29 3.6 05_03_0621 - 16291770-16291786,16292847-16293207 28 8.3 >04_03_0511 - 16664923-16665509,16665600-16665902,16665954-16666218 Length = 384 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 539 GALPYIRGELDERSLKLENYEIDDDIEVSQPLNVPYV 649 G LP G +DE S L NY++ +I +S L++P V Sbjct: 30 GDLPLSPGVMDEASRVLGNYDLLKEILLSLGLHIPLV 66 >05_03_0621 - 16291770-16291786,16292847-16293207 Length = 125 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 282 VGTIRNDNADIHFQVQADYFIFQP 353 + TIR D+ D H ++ ADYF P Sbjct: 58 IKTIRRDHVDAHSRLVADYFAEHP 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,698,123 Number of Sequences: 37544 Number of extensions: 276403 Number of successful extensions: 518 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -