BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0011 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 24 1.2 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.2 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 250 VSIKILVYFRMLALYAMIMRIYISKFKRITSY 345 + IKIL++F +LAL + + ISKF + Y Sbjct: 1 MKIKILLFFTILALINVKAQDDISKFLKDRPY 32 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 381 VNKKCSTHLSVLVHRVFNVVIPQPTE 458 V + H ++L FN++I +PTE Sbjct: 352 VQAEAEKHAAMLYQYNFNIIISEPTE 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,872 Number of Sequences: 438 Number of extensions: 3362 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -