BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0010 (773 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 25 0.67 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.67 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.67 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.1 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 6.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.3 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 25.0 bits (52), Expect = 0.67 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +3 Query: 633 VKTGRSIKELEDEMLNGQKLQGPITAEEVNHMLAN 737 +K+ R+ K+L+D+ +N + + ++H+L N Sbjct: 187 IKSERNGKDLDDDDMNDDDRKDDLLGNNMHHILGN 221 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.0 bits (52), Expect = 0.67 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 156 QRQSSCSWLYFSKQSRADSSDKLMRHHK 73 +R S C ++YF R ++D+L H K Sbjct: 668 KRWSQCMYMYFLLGFRLQANDELSAHSK 695 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.0 bits (52), Expect = 0.67 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 156 QRQSSCSWLYFSKQSRADSSDKLMRHHK 73 +R S C ++YF R ++D+L H K Sbjct: 668 KRWSQCMYMYFLLGFRLQANDELSAHSK 695 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 341 ISYRQTTSGSWWWTMRTQSKYVER 412 +S R++ SG W+W T + R Sbjct: 20 VSSRKSDSGIWYWQCNTDEETCTR 43 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 156 QRQSSCSWLYFSKQSRADSSDKLMRHHK 73 +R S C ++YF R +D+L H K Sbjct: 121 KRWSQCMYMYFLLGFRYLVNDELSAHSK 148 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 156 QRQSSCSWLYFSKQSRADSSDKLMRHHK 73 +R S C ++YF R +D+L H K Sbjct: 435 KRWSQCMYMYFLLGFRYLVNDELSAHSK 462 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,137 Number of Sequences: 336 Number of extensions: 3855 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -