BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0010 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 2.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 2.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.9 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -3 Query: 171 IKSLNQRQSSCSWLYFSKQSRADSSDKLMRHHKY*KISIFCSFNYIW 31 + S+N+ S+CSW +S S + +Y + S + +W Sbjct: 1756 VDSMNENASNCSWEAVDDRSAPSSGANSSQQMQYSSSGVGGSTSVLW 1802 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -3 Query: 171 IKSLNQRQSSCSWLYFSKQSRADSSDKLMRHHKY*KISIFCSFNYIW 31 + S+N+ S+CSW +S S + +Y + S + +W Sbjct: 1757 VDSMNENASNCSWEAVDDRSAPSSGANSSQQMQYSSSGVGGSTSVLW 1803 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 378 HHHDPEVVCLYDIPH*RSQHYVP 310 HHH P + L P + QH P Sbjct: 164 HHHHPGLTGLMQAPSQQQQHLQP 186 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,505 Number of Sequences: 2352 Number of extensions: 16298 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -