BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0009 (808 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 4.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.7 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 804 QANKFKNASDALMSSYLRAGNGLTASLVHKYIDS 703 Q N+F N + L+ L+A T SLV ID+ Sbjct: 205 QMNRFINENSELLFKELQAAYEETFSLVFTKIDN 238 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 701 LIFMWKHWPPKRVS*KLH 648 L+F+WK P +V LH Sbjct: 188 LVFLWKEGDPVQVVKNLH 205 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 701 LIFMWKHWPPKRVS*KLH 648 L+F+WK P +V LH Sbjct: 188 LVFLWKEGDPVQVVKNLH 205 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,930 Number of Sequences: 438 Number of extensions: 2281 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -