BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0009 (808 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54870.1 68416.m06079 armadillo/beta-catenin repeat family pr... 28 6.3 >At3g54870.1 68416.m06079 armadillo/beta-catenin repeat family protein / kinesin motor family protein kinesin, Syncephalastrum racemosum, AJ225894 Length = 941 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 141 VVNTRGKRADQKTAQHHAAETPNMLIKRENVVPSQEKGTF 260 V ++A A+H E N+L K++ + QEKG + Sbjct: 581 VQRVEDEQARSTNAEHQLTEMKNILSKQQKSIHEQEKGNY 620 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,064,934 Number of Sequences: 28952 Number of extensions: 163091 Number of successful extensions: 342 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -