BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0008 (805 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 2.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.6 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 492 VCLLGQNIKLVHLDKSAKCRINFNYTNKKTFTQK 593 +CL + V+ S KC + F++ +KK F K Sbjct: 202 LCLTTFGLLPVNGVTSEKCNLTFSWYSKKVFYSK 235 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = +3 Query: 444 DVS*STVPTLRQAGVLVCLL 503 D++ +TVP+ +Q G+LV ++ Sbjct: 367 DINITTVPSEQQWGILVLII 386 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 486 VLVCLLGQNIKLVHLDKSAKCRINFNYTNKK 578 +++ LL L+HLD ++NF Y K Sbjct: 1238 IVIFLLTLKKDLLHLDWPFDPKVNFTYFEDK 1268 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 486 VLVCLLGQNIKLVHLDKSAKCRINFNYTNKK 578 +++ LL L+HLD ++NF Y K Sbjct: 1238 IVIFLLTLKKDLLHLDWPFDPKVNFTYFEDK 1268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,986 Number of Sequences: 336 Number of extensions: 3273 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -