BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0005 (744 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-... 45 0.002 UniRef50_Q6TVL1 Cluster: ORF109 EEV glycoprotein; n=3; Orf virus... 33 7.4 UniRef50_Q6L039 Cluster: UDP sulfoquinovose synthase; n=2; Therm... 33 9.8 >UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-like protein; n=9; cellular organisms|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 960 Score = 44.8 bits (101), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 180 PSDPITFALDAFSSNTRSRLKDLGN 106 PSDPIT ALD FSSNTRSRL+ GN Sbjct: 923 PSDPITLALDTFSSNTRSRLRSPGN 947 >UniRef50_Q6TVL1 Cluster: ORF109 EEV glycoprotein; n=3; Orf virus|Rep: ORF109 EEV glycoprotein - Orf virus Length = 164 Score = 33.1 bits (72), Expect = 7.4 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 424 ALQILSCHRRVTFLKYKHMQTKF-SGNYPSTRSCYPRES*LDPFTLANNKTVCVISGQ 594 AL++ C + T Y H K G +P + C + DPFTL K++C GQ Sbjct: 55 ALELDKCKEQSTHQDYHHTTNKTCDGLFPENKWCLTK---FDPFTLRQAKSMCTGIGQ 109 >UniRef50_Q6L039 Cluster: UDP sulfoquinovose synthase; n=2; Thermoplasmatales|Rep: UDP sulfoquinovose synthase - Picrophilus torridus Length = 384 Score = 32.7 bits (71), Expect = 9.8 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 730 RNALTL*ANTKGNYCIPNIGVPRFSFNPAVHSRRDF 623 R+A + T G Y PNI +P FN H RRD+ Sbjct: 135 RDAHIIKLGTMGEYGTPNIDIPEGFFNIEYHGRRDY 170 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,731,237 Number of Sequences: 1657284 Number of extensions: 11722779 Number of successful extensions: 25775 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25769 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -