BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0005 (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14096.1 68417.m02176 F-box family protein contains F-box dom... 29 3.3 At1g30860.1 68414.m03774 expressed protein 27 9.9 >At4g14096.1 68417.m02176 F-box family protein contains F-box domain Pfam:PF00646 Length = 468 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -1 Query: 732 SEMHLLCKLILKEIIAFPILEYHDLVLTQLYTL 634 SEM L L+ +++ +P+LE+ D+ L +L TL Sbjct: 131 SEMFLSKTLVRLKLMLYPLLEFEDVYLPKLKTL 163 >At1g30860.1 68414.m03774 expressed protein Length = 730 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 178 WKRSSCQLCKAFIVDTTSLLYNYR 249 W C +C+A IVD ++Y+ R Sbjct: 706 WSGGKCPICRAQIVDVVRVIYDTR 729 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,114,481 Number of Sequences: 28952 Number of extensions: 263832 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -