BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0004 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13697| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 29 3.1 >SB_13697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/53 (22%), Positives = 29/53 (54%) Frame = -1 Query: 513 YVYRLQLEYAIIHLNKYFFIVKRMSVNYIFKHYTVLRHFIRFFFNTYKISLKR 355 YVY ++ + +HL+++ + M++ +F ++V + + +F Y S K+ Sbjct: 259 YVYLFEMFMSTLHLDRWNILCSSMTLERLFGKFSVEKEILGWFVLAYHHSSKK 311 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 219 FEVQQALLRYLLRQFLCILLI*TYTIVTSYPVWL*YLINILIHLFFASNLSY 374 F V Q L+R LL C+LL+ TY I W+ L+ + + A L Y Sbjct: 17 FSVLQMLVRCLLEMVPCVLLLATYLIGILAAAWITALL-VPFPYYIALRLEY 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,514,323 Number of Sequences: 59808 Number of extensions: 369944 Number of successful extensions: 670 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -