BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0003 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.1 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 5.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 7.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 7.1 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 7.1 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 7.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 7.1 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 7.1 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 7.1 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 7.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 7.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 7.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 7.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 7.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 7.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 7.1 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.4 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 607 NQSRIT-GQEEEED*VFSAVSVLLSGKL 687 +Q+ +T G+E++ + FS +SVLL G L Sbjct: 4 SQNNLTDGKEDQPENTFSLLSVLLVGFL 31 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 5.4 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 148 SADSVQQGSIPG-SIRADSV*ELRCRHRSGWKTSG 249 +A S G P +I ADS EL R R G+K +G Sbjct: 168 TAASTVLGFFPALNIVADSFIELIRRQRVGYKVTG 202 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRRPGY 525 K LRN+ + I+ + K+E ++ RR + Sbjct: 16 KQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 442 KDLRNDPATINELRKMKQEPVKRRR 516 K LRN+ + I+ + K+E ++ RR Sbjct: 16 KQLRNEDSKIDLRSRTKEERLQHRR 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,029 Number of Sequences: 438 Number of extensions: 4560 Number of successful extensions: 27 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -