BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0001 (734 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1ZJ37 Cluster: DNA recombination protein RmuC; n=2; Ps... 33 9.6 >UniRef50_Q1ZJ37 Cluster: DNA recombination protein RmuC; n=2; Psychromonas|Rep: DNA recombination protein RmuC - Psychromonas sp. CNPT3 Length = 460 Score = 32.7 bits (71), Expect = 9.6 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +1 Query: 436 PALIFASEN*RPKLIYFYNDNGVPLMLHFST*CLVRPCQCFWQYKLHHLTGNHLACQL-K 612 PA I A E+ P+L+ DN + L + +R + W++ H G H+A Q K Sbjct: 313 PAFIVAIEH-DPELVKLALDNNILLASPTNLMIALRTIENLWRFDQQHKNGRHIAAQASK 371 Query: 613 HHLEVYIISHRYSD 654 + ++ + SH D Sbjct: 372 LYDKLRLFSHNMLD 385 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,401,234 Number of Sequences: 1657284 Number of extensions: 13113255 Number of successful extensions: 23119 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23118 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59677054775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -