Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0001
         (734 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsiv...    23   9.8  

>AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsive
           protein 1 protein.
          Length = 447

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 13/53 (24%), Positives = 25/53 (47%)
 Frame = +1

Query: 7   PKIVPIMFLVFDLRKDSYSIMSRWKRLNKSPQSNSHRV*ESASLSRPTEKIKG 165
           P +   +FL   L KD+   ++      ++P+ N      +A +  PTE++ G
Sbjct: 228 PHVNQTIFLDIPLLKDNIDYVNVAAYDQQTPERNPKEGDYTAPIYEPTERVVG 280


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 712,207
Number of Sequences: 2352
Number of extensions: 13654
Number of successful extensions: 38
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 75260343
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)