BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0096 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.05c |sre2||membrane-tethered transcription factor |Schiz... 29 0.47 SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizo... 25 7.7 >SPBC354.05c |sre2||membrane-tethered transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 793 Score = 29.5 bits (63), Expect = 0.47 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 341 PMDH---THKHNNEQVKFTTSSVVITRVLSLRASQSDDHQYSTIET 469 P++H T KH NE ++ V T+ + L +Q+D +Q S++ + Sbjct: 170 PINHQGNTWKHANESLQSNQGPVPNTKFVGLETTQTDSYQQSSVNS 215 >SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 546 GVIAYASLSVRFAYNGVSRPELVE*VSTSTLVPQEQPSSV 665 G ++ +L++ F + RP+LV V T+ + QP +V Sbjct: 15 GSVSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAV 54 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,302,396 Number of Sequences: 5004 Number of extensions: 43383 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -