BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0096 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 6.8 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 6.8 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.8 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 6.8 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 9.0 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 568 NDAYAITPDVIFWKNLLLDPFYNEDE 491 +D + TP ++ L LDP+Y E Sbjct: 421 SDGWDRTPQIVATAQLCLDPYYRTIE 446 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 568 NDAYAITPDVIFWKNLLLDPFYNEDE 491 +D + TP ++ L LDP+Y E Sbjct: 421 SDGWDRTPQIVATAQLCLDPYYRTIE 446 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 6.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 598 ETPLYANLTDNDAYAITPDVIFWKNLLLDPFYNEDEEDE 482 ET L T +DAY++ FW L P N D+E E Sbjct: 588 ETILKNPATSSDAYSLIALGNFWLQSLHQP--NRDKEKE 624 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.4 bits (48), Expect = 6.8 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = -1 Query: 553 ITPDVIFWKNLLLDPFYNEDEEDEVGTI-CFYC*ILMIV*--LRRA*GQDARNHNATGCK 383 +T V+F K++L F +E ++ G+I C ++I+ L +A G D + GC Sbjct: 265 VTECVLFHKDIL--SFGDEVQDIFQGSIFAQVCASVIIICMTLLQATGDDVTMADLLGCG 322 Query: 382 FYLFII 365 FYL ++ Sbjct: 323 FYLLVM 328 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 429 ARKDRTRVITTLLVVNFTCSLLCLCV 352 ARK + R + +VN S L LC+ Sbjct: 67 ARKPQMRTARNMFIVNLAVSDLLLCL 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,943 Number of Sequences: 2352 Number of extensions: 9813 Number of successful extensions: 59 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -