BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0096 (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC029155-1|AAH29155.1| 489|Homo sapiens CYP7B1 protein protein. 31 2.9 AF176805-1|AAK11850.1| 506|Homo sapiens oxysterol 7alpha-hydrox... 31 2.9 AF127090-1|AAD20021.1| 506|Homo sapiens oxysterol 7alpha-hydrox... 31 2.9 AF029403-1|AAC95426.1| 506|Homo sapiens oxysterol 7alpha-hydrox... 31 2.9 >BC029155-1|AAH29155.1| 489|Homo sapiens CYP7B1 protein protein. Length = 489 Score = 31.5 bits (68), Expect = 2.9 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 200 IVLCDNVTFLSKLH*NYVLSYDAKFKYLLKKVNI 99 +++CDN F+S+L ++ L +D KF YL+ + I Sbjct: 200 VIVCDNNKFISELRDDF-LKFDDKFAYLVSNIPI 232 >AF176805-1|AAK11850.1| 506|Homo sapiens oxysterol 7alpha-hydroxylase protein. Length = 506 Score = 31.5 bits (68), Expect = 2.9 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 200 IVLCDNVTFLSKLH*NYVLSYDAKFKYLLKKVNI 99 +++CDN F+S+L ++ L +D KF YL+ + I Sbjct: 200 VIVCDNNKFISELRDDF-LKFDDKFAYLVSNIPI 232 >AF127090-1|AAD20021.1| 506|Homo sapiens oxysterol 7alpha-hydroxylase protein. Length = 506 Score = 31.5 bits (68), Expect = 2.9 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 200 IVLCDNVTFLSKLH*NYVLSYDAKFKYLLKKVNI 99 +++CDN F+S+L ++ L +D KF YL+ + I Sbjct: 200 VIVCDNNKFISELRDDF-LKFDDKFAYLVSNIPI 232 >AF029403-1|AAC95426.1| 506|Homo sapiens oxysterol 7alpha-hydroxylase protein. Length = 506 Score = 31.5 bits (68), Expect = 2.9 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 200 IVLCDNVTFLSKLH*NYVLSYDAKFKYLLKKVNI 99 +++CDN F+S+L ++ L +D KF YL+ + I Sbjct: 200 VIVCDNNKFISELRDDF-LKFDDKFAYLVSNIPI 232 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,316,703 Number of Sequences: 237096 Number of extensions: 1339854 Number of successful extensions: 2056 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2056 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -