BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0096 (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75550-2|CAA99928.2| 421|Caenorhabditis elegans Hypothetical pr... 31 1.0 Z99283-2|CAB16535.1| 274|Caenorhabditis elegans Hypothetical pr... 27 9.4 AF002196-7|AAB53977.1| 254|Caenorhabditis elegans Hypothetical ... 27 9.4 >Z75550-2|CAA99928.2| 421|Caenorhabditis elegans Hypothetical protein T22C1.3 protein. Length = 421 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 12 FLIFDLHINWIG-LFN*GSDFSSIQPRYTIYVYFLKQIFE 128 +L+ + +N++G ++ +FSSIQP +Y YF QIFE Sbjct: 232 YLLNNQSLNFLGPVYASILNFSSIQPNSGLYWYFFVQIFE 271 >Z99283-2|CAB16535.1| 274|Caenorhabditis elegans Hypothetical protein Y70C5C.3 protein. Length = 274 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -3 Query: 380 LPVHYCVCVCDPLDTTKYCIFINDSIRVIASN 285 LP++YC + +D K C+F + ++R + S+ Sbjct: 146 LPINYCPVTSNIIDGDKVCVFEDMNVRNLDSD 177 >AF002196-7|AAB53977.1| 254|Caenorhabditis elegans Hypothetical protein C09D4.2 protein. Length = 254 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 350 HTHKHNNE-QVKFTTSSVVITRVLSLRASQSDDHQYSTIETNC 475 H H + ++K +TS V+ + LSLR S+++ + + NC Sbjct: 103 HMTVHTDSYKMKVSTSKQVVRKELSLRTGSSNENGCACVHGNC 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,672,970 Number of Sequences: 27780 Number of extensions: 242701 Number of successful extensions: 545 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -