BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0095 (491 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 3e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 0.27 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 5.7 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 5.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 22 9.9 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 3e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +3 Query: 69 MRECISVHVGQAGVQIGNACWE 134 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 41.1 bits (92), Expect = 2e-05 Identities = 26/68 (38%), Positives = 28/68 (41%) Frame = +1 Query: 124 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPVXXXXXXXXXXXXXX 303 P T WS AS+ RCP+TR S ST SS R AST PV Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRC 78 Query: 304 XXAHTDSC 327 A T SC Sbjct: 79 APARTASC 86 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.9 bits (79), Expect = 8e-04 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 387 HYTIGKEILNLVLDIIHKLTYQCTILQRFLIFHS 488 HYT G E+++ VLD++ K C LQ F + HS Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHS 34 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.9 bits (79), Expect = 8e-04 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 387 HYTIGKEILNLVLDIIHKLTYQCTILQRFLIFHS 488 HYT G E+++ VLD++ K C LQ F + HS Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHS 34 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.9 bits (79), Expect = 8e-04 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 387 HYTIGKEILNLVLDIIHKLTYQCTILQRFLIFHS 488 HYT G E+++ VLD++ K C LQ F + HS Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHS 34 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.9 bits (79), Expect = 8e-04 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 387 HYTIGKEILNLVLDIIHKLTYQCTILQRFLIFHS 488 HYT G E+++ VLD++ K C LQ F + HS Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHS 34 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect(2) = 0.27 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 175 CPQTRPSGVETILSTLSSARPELAS 249 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 Score = 21.8 bits (44), Expect(2) = 0.27 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 118 VMPAGSFTAWSTASSLMARCPQTRPSGV 201 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 5.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 197 GWRRFFQHFLQRDRSWQAR 253 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 405 EILNLVLDIIHKLTYQCTILQR 470 E+L + DI+ K Q T+LQR Sbjct: 343 ELLGIATDILGKALRQQTVLQR 364 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 7.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 98 PSRSPDR*CLLGALLPGARHPA*WPDAHRQDHR 196 P+ P + L+ +LP + PA P R+D R Sbjct: 1107 PAVEPAKKTLVATILPNSAKPAQQPPPLRRDAR 1139 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 22.2 bits (45), Expect = 9.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 225 RKC*KNRLHPRWSCLWASGHQAGCRAPGSKAPSRHYR 115 RK +R +PR + G CR+P ++ SR R Sbjct: 248 RKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTR 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,818 Number of Sequences: 2352 Number of extensions: 11811 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -