BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0094 (1287 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12523| Best HMM Match : PROCT (HMM E-Value=0) 308 5e-84 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 47 4e-05 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 46 5e-05 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-05 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-05 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-05 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-05 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-05 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 45 2e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 44 2e-04 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 44 3e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 44 3e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 44 3e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 44 3e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 44 3e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 44 3e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 41 4e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 43 5e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 42 8e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 42 8e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 42 0.001 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 42 0.001 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 42 0.001 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 42 0.001 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 42 0.001 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 42 0.001 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 41 0.002 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 41 0.002 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 0.002 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 41 0.002 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 41 0.002 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 41 0.002 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 41 0.002 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 0.002 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 41 0.002 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 41 0.002 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 0.002 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 41 0.002 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 41 0.002 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 41 0.002 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 41 0.002 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 41 0.002 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 41 0.002 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 41 0.002 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 41 0.002 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 41 0.002 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 41 0.002 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 41 0.002 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 41 0.002 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 41 0.002 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 41 0.002 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 41 0.002 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 41 0.002 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 41 0.002 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 41 0.002 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 41 0.002 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 41 0.002 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 41 0.002 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 41 0.002 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 41 0.002 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 41 0.002 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 41 0.002 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 0.002 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 41 0.002 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 >SB_12523| Best HMM Match : PROCT (HMM E-Value=0) Length = 165 Score = 308 bits (757), Expect = 5e-84 Identities = 130/165 (78%), Positives = 150/165 (90%) Frame = -2 Query: 638 LQPLGWMHTQPNELPQLSPQDITTHAKIMSDNSSWDGEKTIIITCSFTPGSCSLTAYKLT 459 ++PLGW+HTQPNELPQL+PQD+TTHAKIM+DN SWDGEKT+IITCSFTPGSCSLTAYKLT Sbjct: 2 MEPLGWIHTQPNELPQLAPQDVTTHAKIMADNPSWDGEKTVIITCSFTPGSCSLTAYKLT 61 Query: 458 PSGYEWGVRNTDRGNNPKGYLPSHYERVQMLLSDRFLGYFMVPSQGSWNYNFMGVRHDPN 279 PSGY+WG N D GNNP+GYLPSHYERVQMLLSDRFLG+FMVP+QGSWNYNFMGVRH N Sbjct: 62 PSGYDWGRNNKDTGNNPRGYLPSHYERVQMLLSDRFLGFFMVPAQGSWNYNFMGVRHSAN 121 Query: 278 MKYGVQLGNPREFYHEVHRPAHFMNFAAMEDAAAPTIAADREDLF 144 M+Y +QL NP++FYHEVHRP+HF+NF+ MED + I ADRED+F Sbjct: 122 MRYELQLSNPKDFYHEVHRPSHFLNFSTMED--SELIGADREDMF 164 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.4 bits (110), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 PRP NSCSPGDPLVLERPPP Sbjct: 24 PRPSNSCSPGDPLVLERPPP 43 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.2 bits (107), Expect = 3e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P+P NSCSPGDPLVLERPPP Sbjct: 12 PKPSNSCSPGDPLVLERPPP 31 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 46.8 bits (106), Expect = 4e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -2 Query: 104 LYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 L+ + K +P NSCSPGDPLVLERPPP Sbjct: 75 LHESVPKSEPLSSNSCSPGDPLVLERPPP 103 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 46.4 bits (105), Expect = 5e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P P NSCSPGDPLVLERPPP Sbjct: 166 PEPSNSCSPGDPLVLERPPP 185 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 5e-05 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 I K P P NSCSPGDPLVLERPPP Sbjct: 13 IYKVLPAPSNSCSPGDPLVLERPPP 37 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 46.0 bits (104), Expect = 7e-05 Identities = 21/37 (56%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -2 Query: 125 SIFHCVSLYVVIEKKDPRPP-NSCSPGDPLVLERPPP 18 +I +C V+I +P NSCSPGDPLVLERPPP Sbjct: 12 NILYCNKQLVIIRATRRKPQSNSCSPGDPLVLERPPP 48 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 46.0 bits (104), Expect = 7e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E+K R NSCSPGDPLVLERPPP Sbjct: 2 ERKGDRRSNSCSPGDPLVLERPPP 25 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 45.6 bits (103), Expect = 9e-05 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 + K P NSCSPGDPLVLERPPP Sbjct: 56 LRNKHTNPSNSCSPGDPLVLERPPP 80 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 9e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 RP NSCSPGDPLVLERPPP Sbjct: 16 RPSNSCSPGDPLVLERPPP 34 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.6 bits (103), Expect = 9e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 DP NSCSPGDPLVLERPPP Sbjct: 23 DPNTSNSCSPGDPLVLERPPP 43 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 9e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E + +P NSCSPGDPLVLERPPP Sbjct: 13 EVRGSKPSNSCSPGDPLVLERPPP 36 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.2 bits (102), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 PR NSCSPGDPLVLERPPP Sbjct: 8 PRASNSCSPGDPLVLERPPP 27 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 116 HCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 HC SL ++I NSCSPGDPLVLERPPP Sbjct: 21 HC-SLILLIVPNATAQSNSCSPGDPLVLERPPP 52 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 PR NSCSPGDPLVLERPPP Sbjct: 16 PRESNSCSPGDPLVLERPPP 35 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -2 Query: 110 VSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 + +++I + PR NSCSPGDPLVLERPPP Sbjct: 57 IDTFILILQPHPRS-NSCSPGDPLVLERPPP 86 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 I K R NSCSPGDPLVLERPPP Sbjct: 45 IVKSSSRASNSCSPGDPLVLERPPP 69 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 DP NSCSPGDPLVLERPPP Sbjct: 42 DPARSNSCSPGDPLVLERPPP 62 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 PR NSCSPGDPLVLERPPP Sbjct: 57 PRRSNSCSPGDPLVLERPPP 76 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = -2 Query: 92 IEKKD---PRPPNSCSPGDPLVLERPPP 18 + KKD P NSCSPGDPLVLERPPP Sbjct: 65 VSKKDWIVDNPSNSCSPGDPLVLERPPP 92 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 2e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 ++ D R NSCSPGDPLVLERPPP Sbjct: 6 KQTDDRTSNSCSPGDPLVLERPPP 29 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 131 PRSIFHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 P +++ Y+ + +P NSCSPGDPLVLERPPP Sbjct: 25 PVALYGLDRTYLFVLLVANKPSNSCSPGDPLVLERPPP 62 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 44.8 bits (101), Expect = 2e-04 Identities = 19/22 (86%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -2 Query: 80 DPRPP-NSCSPGDPLVLERPPP 18 D +PP NSCSPGDPLVLERPPP Sbjct: 93 DAQPPSNSCSPGDPLVLERPPP 114 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 107 SLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 SL V+ P NSCSPGDPLVLERPPP Sbjct: 171 SLTVIAGTTTIPPSNSCSPGDPLVLERPPP 200 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 + K P NSCSPGDPLVLERPPP Sbjct: 11 DPKRPHRSNSCSPGDPLVLERPPP 34 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 +P NSCSPGDPLVLERPPP Sbjct: 8 KPSNSCSPGDPLVLERPPP 26 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 98 VVIEKKDPRPPNSCSPGDPLVLERPPP 18 +V+ K++ NSCSPGDPLVLERPPP Sbjct: 26 LVVPKQESIRSNSCSPGDPLVLERPPP 52 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 3e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 +++ R NSCSPGDPLVLERPPP Sbjct: 17 KRRSKRASNSCSPGDPLVLERPPP 40 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 3e-04 Identities = 31/66 (46%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -2 Query: 209 MNFAAMEDAAAPTIAADREDLFA*I*PRSIFH--CVSLYVVIEKKDPRPPNSCSPGDPLV 36 M ME A DRE L R IF C Y ++KK+ NSCSPGDPLV Sbjct: 1 MGLGMMEAADVVLSPVDREPLKV----RGIFDKVCSGPYY-LQKKNAS--NSCSPGDPLV 53 Query: 35 LERPPP 18 LERPPP Sbjct: 54 LERPPP 59 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 3e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -2 Query: 95 VIEKKDPRPPNSCSPGDPLVLERPPP 18 +I P+ NSCSPGDPLVLERPPP Sbjct: 8 LISANIPKRSNSCSPGDPLVLERPPP 33 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 17 PSNSCSPGDPLVLERPPP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 26 PSNSCSPGDPLVLERPPP 43 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -2 Query: 83 KDPRPPNSCSPGDPLVLERPPP 18 K R NSCSPGDPLVLERPPP Sbjct: 3 KSDRVSNSCSPGDPLVLERPPP 24 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 20 PSNSCSPGDPLVLERPPP 37 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/31 (67%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -2 Query: 107 SLYVVIEKKDPRPP-NSCSPGDPLVLERPPP 18 SL I +PR NSCSPGDPLVLERPPP Sbjct: 4 SLIFTIPYHNPRTTSNSCSPGDPLVLERPPP 34 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 42 PSNSCSPGDPLVLERPPP 59 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 86 KKDPRPPNSCSPGDPLVLERPPP 18 K D NSCSPGDPLVLERPPP Sbjct: 19 KNDALSSNSCSPGDPLVLERPPP 41 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -2 Query: 92 IEKKDPR-PPNSCSPGDPLVLERPPP 18 I++K P NSCSPGDPLVLERPPP Sbjct: 183 IQRKQPACSSNSCSPGDPLVLERPPP 208 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 19 PSNSCSPGDPLVLERPPP 36 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 8 PSNSCSPGDPLVLERPPP 25 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 56 PSNSCSPGDPLVLERPPP 73 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 156 PSNSCSPGDPLVLERPPP 173 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 20 PSNSCSPGDPLVLERPPP 37 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 136 PSNSCSPGDPLVLERPPP 153 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 5 PSNSCSPGDPLVLERPPP 22 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 19 PSNSCSPGDPLVLERPPP 36 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 I + P NSCSPGDPLVLERPPP Sbjct: 4 IREAQPVTSNSCSPGDPLVLERPPP 28 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 28 PSNSCSPGDPLVLERPPP 45 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 22 PSNSCSPGDPLVLERPPP 39 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 7 PSNSCSPGDPLVLERPPP 24 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -2 Query: 116 HCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 +C ++ + EKK NSCSPGDPLVLERPPP Sbjct: 10 NCENIITLQEKKS----NSCSPGDPLVLERPPP 38 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 40 PSNSCSPGDPLVLERPPP 57 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 14 PSNSCSPGDPLVLERPPP 31 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 66 PSNSCSPGDPLVLERPPP 83 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 55 PSNSCSPGDPLVLERPPP 72 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 111 PSNSCSPGDPLVLERPPP 128 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 8 PSNSCSPGDPLVLERPPP 25 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 44 PSNSCSPGDPLVLERPPP 61 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 7 PSNSCSPGDPLVLERPPP 24 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P+ NSCSPGDPLVLERPPP Sbjct: 12 PQKSNSCSPGDPLVLERPPP 31 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 35 PSNSCSPGDPLVLERPPP 52 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 14 PSNSCSPGDPLVLERPPP 31 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 10 PSNSCSPGDPLVLERPPP 27 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 14 PSNSCSPGDPLVLERPPP 31 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 46 PSNSCSPGDPLVLERPPP 63 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 13 PSNSCSPGDPLVLERPPP 30 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -2 Query: 110 VSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 V +V+ + NSCSPGDPLVLERPPP Sbjct: 11 VMAVIVVRSRKTISSNSCSPGDPLVLERPPP 41 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 7 PSNSCSPGDPLVLERPPP 24 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -2 Query: 128 RSIFHCVSLYVVIEKKD---PRPPNSCSPGDPLVLERPPP 18 RS+ C L V ++D R NSCSPGDPLVLERPPP Sbjct: 6 RSVVECGGLRAV--RRDCCRSRGSNSCSPGDPLVLERPPP 43 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 72 PSNSCSPGDPLVLERPPP 89 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E ++ R NSCSPGDPLVLERPPP Sbjct: 5 EYREYRGSNSCSPGDPLVLERPPP 28 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 29 PSNSCSPGDPLVLERPPP 46 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 23 PSNSCSPGDPLVLERPPP 40 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P+ NSCSPGDPLVLERPPP Sbjct: 5 PQASNSCSPGDPLVLERPPP 24 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 515 PSNSCSPGDPLVLERPPP 532 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 53 PGDPLVLERPPP 18 PGDPLVLERPPP Sbjct: 664 PGDPLVLERPPP 675 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 110 VSLYVV-IEKKDPRPPNSCSPGDPLVLERPPP 18 + LY+V ++K NSCSPGDPLVLERPPP Sbjct: 3 IQLYLVSVDKIADFVSNSCSPGDPLVLERPPP 34 >SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 3 PSNSCSPGDPLVLERPPP 20 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 14 PSNSCSPGDPLVLERPPP 31 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 19 PSNSCSPGDPLVLERPPP 36 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 71 PPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 71 PSNSCSPGDPLVLERPPP 88 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 41.1 bits (92), Expect(2) = 4e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 350 NSCSPGDPLVLERPPP 365 Score = 21.4 bits (43), Expect(2) = 4e-04 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -2 Query: 131 PRSIFHCVSLYVVIEKKDPRPPNSCSPGDPL 39 P FHC + P P++C P P+ Sbjct: 299 PIPTFHCTQYPQYLHSIVPSTPSTCIPLYPV 329 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -2 Query: 131 PRSIFHCVSL--YVVIEKKDPRPPNSCSPGDPLVLERPPP 18 P S+ CV + + + E + NSCSPGDPLVLERPPP Sbjct: 40 PGSLIKCVYIRCHHMDEPTAKKLSNSCSPGDPLVLERPPP 79 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 ++K + NSCSPGDPLVLERPPP Sbjct: 234 LDKLKKKTSNSCSPGDPLVLERPPP 258 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E K R NSCSPGDPLVLERPPP Sbjct: 71 EIKRYRESNSCSPGDPLVLERPPP 94 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -2 Query: 119 FHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 F C+ +++ D NSCSPGDPLVLERPPP Sbjct: 15 FWCLVFILLVH--DHNQSNSCSPGDPLVLERPPP 46 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -2 Query: 86 KKDPRP-PNSCSPGDPLVLERPPP 18 +K RP NSCSPGDPLVLERPPP Sbjct: 11 RKPARPRSNSCSPGDPLVLERPPP 34 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 43.2 bits (97), Expect = 5e-04 Identities = 20/30 (66%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -2 Query: 104 LYVVIEKK-DPRPPNSCSPGDPLVLERPPP 18 L + IE+K + NSCSPGDPLVLERPPP Sbjct: 40 LSINIERKTEDTTSNSCSPGDPLVLERPPP 69 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -2 Query: 110 VSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 +S + + + + NSCSPGDPLVLERPPP Sbjct: 9 ISANIGVSNQTKQSSNSCSPGDPLVLERPPP 39 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 +E++ NSCSPGDPLVLERPPP Sbjct: 17 VERQHVAASNSCSPGDPLVLERPPP 41 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 ++ + R NSCSPGDPLVLERPPP Sbjct: 12 LDHTERRASNSCSPGDPLVLERPPP 36 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 62 PETSNSCSPGDPLVLERPPP 81 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.2 bits (97), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 +P NSCSPGDPLVLERPPP Sbjct: 5 EPLASNSCSPGDPLVLERPPP 25 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 43.2 bits (97), Expect = 5e-04 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -2 Query: 98 VVIEKKDPRP--PNSCSPGDPLVLERPPP 18 VVIE PR NSCSPGDPLVLERPPP Sbjct: 580 VVIEGWYPRVGISNSCSPGDPLVLERPPP 608 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.7 bits (96), Expect = 6e-04 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 107 SLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 +LYV +E+ NSCSPGDPLVLERPPP Sbjct: 5 TLYVKLERS-----NSCSPGDPLVLERPPP 29 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 86 KKDPRPPNSCSPGDPLVLERPPP 18 ++ P NSCSPGDPLVLERPPP Sbjct: 41 REGPGGSNSCSPGDPLVLERPPP 63 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.7 bits (96), Expect = 6e-04 Identities = 19/27 (70%), Positives = 21/27 (77%), Gaps = 2/27 (7%) Frame = -2 Query: 92 IEKKDPR--PPNSCSPGDPLVLERPPP 18 + K+D R NSCSPGDPLVLERPPP Sbjct: 3 LNKRDERLSTSNSCSPGDPLVLERPPP 29 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 6e-04 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -2 Query: 131 PRSIFHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 PR+ F C + V + + NSCSPGDPLVLERPPP Sbjct: 2 PRTNFDCENQLFV--QGNCMKSNSCSPGDPLVLERPPP 37 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.7 bits (96), Expect = 6e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 98 VVIEKKDPRPPNSCSPGDPLVLERPPP 18 V + P NSCSPGDPLVLERPPP Sbjct: 16 VTTRESTPFGSNSCSPGDPLVLERPPP 42 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 + + P NSCSPGDPLVLERPPP Sbjct: 14 VREAAPLASNSCSPGDPLVLERPPP 38 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 101 YVVIEKKDPRPPNSCSPGDPLVLERPPP 18 Y ++ + NSCSPGDPLVLERPPP Sbjct: 17 YAILSPRARLVSNSCSPGDPLVLERPPP 44 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 160 PHLSNSCSPGDPLVLERPPP 179 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 21 RESNSCSPGDPLVLERPPP 39 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 86 KKDPRPPNSCSPGDPLVLERPPP 18 K+ NSCSPGDPLVLERPPP Sbjct: 78 KRQQMASNSCSPGDPLVLERPPP 100 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 21 RKSNSCSPGDPLVLERPPP 39 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 101 RTSNSCSPGDPLVLERPPP 119 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 42.3 bits (95), Expect = 8e-04 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 119 FHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 F CVS V++K NSCSPGDPLVLERPPP Sbjct: 62 FSCVSC--VVQKS-----NSCSPGDPLVLERPPP 88 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 86 KKDPRPPNSCSPGDPLVLERPPP 18 +K NSCSPGDPLVLERPPP Sbjct: 61 RKSSTTSNSCSPGDPLVLERPPP 83 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 23 RQSNSCSPGDPLVLERPPP 41 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 42.3 bits (95), Expect = 8e-04 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 98 VVIEKKDPRPPNSCSPGDPLVLERPPP 18 V ++ +D R NSCSPGDPLVLERPPP Sbjct: 102 VGLKHRDQRS-NSCSPGDPLVLERPPP 127 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 6 RTSNSCSPGDPLVLERPPP 24 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 D + NSCSPGDPLVLERPPP Sbjct: 18 DHKGSNSCSPGDPLVLERPPP 38 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 18 RESNSCSPGDPLVLERPPP 36 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 13 RASNSCSPGDPLVLERPPP 31 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 10 PMVSNSCSPGDPLVLERPPP 29 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.3 bits (95), Expect = 8e-04 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 113 CVSLYVVIEKKDPRP-PNSCSPGDPLVLERPPP 18 C L V+++ + + NSCSPGDPLVLERPPP Sbjct: 16 CNRLGVIVKPEGNKDVSNSCSPGDPLVLERPPP 48 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 2 RKSNSCSPGDPLVLERPPP 20 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 5 RSSNSCSPGDPLVLERPPP 23 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 10 RTSNSCSPGDPLVLERPPP 28 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 9 RASNSCSPGDPLVLERPPP 27 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -2 Query: 125 SIFHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 S+ S+ + IE + R NSCSPGDPLVLERPPP Sbjct: 38 SLVPSTSVTLFIENRLMRS-NSCSPGDPLVLERPPP 72 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 42.3 bits (95), Expect = 8e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 104 LYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 +Y VI+K NSCSPGDPLVLERPPP Sbjct: 20 VYTVIQKV---VSNSCSPGDPLVLERPPP 45 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 4 RASNSCSPGDPLVLERPPP 22 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 8e-04 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -2 Query: 92 IEKKDPRP-PNSCSPGDPLVLERPPP 18 I+KK + NSCSPGDPLVLERPPP Sbjct: 22 IQKKGAKEISNSCSPGDPLVLERPPP 47 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.3 bits (95), Expect = 8e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 +EK NSCSPGDPLVLERPPP Sbjct: 31 VEKFKKCTSNSCSPGDPLVLERPPP 55 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 8e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 8 PEISNSCSPGDPLVLERPPP 27 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 83 KDPRPPNSCSPGDPLVLERPPP 18 +D NSCSPGDPLVLERPPP Sbjct: 2 RDGGASNSCSPGDPLVLERPPP 23 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 380 RRSNSCSPGDPLVLERPPP 398 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E+ + NSCSPGDPLVLERPPP Sbjct: 9 ERSASQVSNSCSPGDPLVLERPPP 32 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 2 PLVSNSCSPGDPLVLERPPP 21 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 113 CVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 C+SL + D NSCSPGDPLVLERPPP Sbjct: 25 CMSLSLA-RPYDNIASNSCSPGDPLVLERPPP 55 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 39 RGSNSCSPGDPLVLERPPP 57 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = -2 Query: 110 VSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 + L V K NSCSPGDPLVLERPPP Sbjct: 5 IGLEVTFGKSFRVTSNSCSPGDPLVLERPPP 35 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 2 RRSNSCSPGDPLVLERPPP 20 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 39 RVSNSCSPGDPLVLERPPP 57 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 183 RVSNSCSPGDPLVLERPPP 201 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 +P NSCSPGDPLVLERPPP Sbjct: 53 EPILSNSCSPGDPLVLERPPP 73 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E ++ NSCSPGDPLVLERPPP Sbjct: 1060 ELEEKEVSNSCSPGDPLVLERPPP 1083 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 4 PFSSNSCSPGDPLVLERPPP 23 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 31 RVSNSCSPGDPLVLERPPP 49 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -2 Query: 131 PRSIFHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 P+S VS Y I+ + NSCSPGDPLVLERPPP Sbjct: 58 PKSKPRNVSDYPWIDHELRFLSNSCSPGDPLVLERPPP 95 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 89 EKKDPRPPNSCSPGDPLVLERPPP 18 E +D NSCSPGDPLVLERPPP Sbjct: 182 EVQDLCKSNSCSPGDPLVLERPPP 205 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 5 RRSNSCSPGDPLVLERPPP 23 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 7 RRSNSCSPGDPLVLERPPP 25 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 95 VIEKKDPRPPNSCSPGDPLVLERPPP 18 + EK NSCSPGDPLVLERPPP Sbjct: 20 IAEKHVKFTSNSCSPGDPLVLERPPP 45 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 24 RRSNSCSPGDPLVLERPPP 42 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 1191 PFASNSCSPGDPLVLERPPP 1210 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 83 KDPRPPNSCSPGDPLVLERPPP 18 K+ + NSCSPGDPLVLERPPP Sbjct: 3 KNSQLSNSCSPGDPLVLERPPP 24 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 8 PGVSNSCSPGDPLVLERPPP 27 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 57 PPVSNSCSPGDPLVLERPPP 76 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -2 Query: 119 FHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 F V+L + + + NSCSPGDPLVLERPPP Sbjct: 28 FQKVTLGKIKQYTRKKRSNSCSPGDPLVLERPPP 61 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 3 RVSNSCSPGDPLVLERPPP 21 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 15 PITSNSCSPGDPLVLERPPP 34 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 59 RRSNSCSPGDPLVLERPPP 77 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 35 PALSNSCSPGDPLVLERPPP 54 >SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 7 PYGSNSCSPGDPLVLERPPP 26 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 2 RRSNSCSPGDPLVLERPPP 20 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 8 RVSNSCSPGDPLVLERPPP 26 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 70 RGSNSCSPGDPLVLERPPP 88 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 43 PTISNSCSPGDPLVLERPPP 62 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 86 KKDPRPPNSCSPGDPLVLERPPP 18 KK NSCSPGDPLVLERPPP Sbjct: 12 KKAGGGSNSCSPGDPLVLERPPP 34 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -2 Query: 131 PRSIFHCVSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 PR ++ + LY + K NSCSPGDPLVLERPPP Sbjct: 11 PRELYLGL-LYPTEDYKVYPVSNSCSPGDPLVLERPPP 47 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -2 Query: 110 VSLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 + LY +E NSCSPGDPLVLERPPP Sbjct: 5 IFLYGFVELISFLISNSCSPGDPLVLERPPP 35 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 23 RLSNSCSPGDPLVLERPPP 41 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/33 (60%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -2 Query: 110 VSLYVVIEKKDPR--PPNSCSPGDPLVLERPPP 18 VSL ++ + R NSCSPGDPLVLERPPP Sbjct: 3 VSLLLISRSRPGRLLVSNSCSPGDPLVLERPPP 35 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 D NSCSPGDPLVLERPPP Sbjct: 4 DDEISNSCSPGDPLVLERPPP 24 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 53 PLLSNSCSPGDPLVLERPPP 72 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/28 (64%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = -2 Query: 98 VVIEKKDPR-PPNSCSPGDPLVLERPPP 18 + +E + P+ NSCSPGDPLVLERPPP Sbjct: 57 IFMEGRFPKLSSNSCSPGDPLVLERPPP 84 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 31 RISNSCSPGDPLVLERPPP 49 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 23 PLISNSCSPGDPLVLERPPP 42 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 83 KDPRPPNSCSPGDPLVLERPPP 18 K NSCSPGDPLVLERPPP Sbjct: 9 KQQATSNSCSPGDPLVLERPPP 30 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 95 VIEKKDPRPPNSCSPGDPLVLERPPP 18 ++EK+ NSCSPGDPLVLERPPP Sbjct: 20 IVEKRS----NSCSPGDPLVLERPPP 41 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -2 Query: 98 VVIEKKDPRPPNSCSPGDPLVLERPPP 18 V ++++ NSCSPGDPLVLERPPP Sbjct: 4 VSLDRESYALSNSCSPGDPLVLERPPP 30 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 14 PFRSNSCSPGDPLVLERPPP 33 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 + K + NSCSPGDPLVLERPPP Sbjct: 32 LNKTAIKASNSCSPGDPLVLERPPP 56 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 80 DPRPPNSCSPGDPLVLERPPP 18 + + NSCSPGDPLVLERPPP Sbjct: 46 EKKTSNSCSPGDPLVLERPPP 66 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 77 PRPPNSCSPGDPLVLERPPP 18 P NSCSPGDPLVLERPPP Sbjct: 52 PFRSNSCSPGDPLVLERPPP 71 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 92 IEKKDPRPPNSCSPGDPLVLERPPP 18 IE K R NSCSPGDPLVLERPPP Sbjct: 13 IENKCCRS-NSCSPGDPLVLERPPP 36 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -2 Query: 107 SLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 S +++ + + NSCSPGDPLVLERPPP Sbjct: 17 SEHIIKSRCSCQSSNSCSPGDPLVLERPPP 46 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 74 RPPNSCSPGDPLVLERPPP 18 R NSCSPGDPLVLERPPP Sbjct: 13 RLSNSCSPGDPLVLERPPP 31 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -2 Query: 107 SLYVVIEKKDPRPPNSCSPGDPLVLERPPP 18 S+Y + K NSCSPGDPLVLERPPP Sbjct: 85 SIYGHEDIKRALASNSCSPGDPLVLERPPP 114 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 11 NSCSPGDPLVLERPPP 26 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 80 NSCSPGDPLVLERPPP 95 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 103 NSCSPGDPLVLERPPP 118 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 83 NSCSPGDPLVLERPPP 98 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 517 NSCSPGDPLVLERPPP 532 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 32 NSCSPGDPLVLERPPP 47 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 55 NSCSPGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 263 NSCSPGDPLVLERPPP 278 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 26 NSCSPGDPLVLERPPP 41 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 49 NSCSPGDPLVLERPPP 64 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 114 NSCSPGDPLVLERPPP 129 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 894 NSCSPGDPLVLERPPP 909 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 95 NSCSPGDPLVLERPPP 110 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 66 NSCSPGDPLVLERPPP 81 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 877 NSCSPGDPLVLERPPP 892 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 65 NSCSPGDPLVLERPPP 80 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 22 NSCSPGDPLVLERPPP 37 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 41 NSCSPGDPLVLERPPP 56 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 143 NSCSPGDPLVLERPPP 158 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 484 NSCSPGDPLVLERPPP 499 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 82 NSCSPGDPLVLERPPP 97 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 37 NSCSPGDPLVLERPPP 52 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 62 NSCSPGDPLVLERPPP 77 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.002 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 65 NSCSPGDPLVLERPPP 18 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,269,542 Number of Sequences: 59808 Number of extensions: 643554 Number of successful extensions: 3638 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3586 length of database: 16,821,457 effective HSP length: 84 effective length of database: 11,797,585 effective search space used: 4058369240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -