BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0094 (1287 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 25 6.3 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 24 8.3 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 24.6 bits (51), Expect = 6.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 698 GTHQQVHLPKHLPKHPALAHLQPLGWMHTQPNELPQL 588 G +VH+ +H H LAHL +G + + P L Sbjct: 80 GNKIRVHIFEHAANHHHLAHLARVGLYGSSRKQKPVL 116 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 24.2 bits (50), Expect = 8.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 184 LQRQQSPPTEKTCSHKF 134 LQR Q PPT C+ F Sbjct: 211 LQRNQQPPTADCCTRAF 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,004,461 Number of Sequences: 2352 Number of extensions: 19674 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 66 effective length of database: 408,747 effective search space used: 147966414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -