BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0092 (617 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 28 0.94 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 28 0.94 SPBC1861.01c |cnp3|SPBC56F2.13|CENP-C|Schizosaccharomyces pombe|... 27 2.9 SPAC56F8.16 |esc1||transcription factor Esc1 |Schizosaccharomyce... 25 8.8 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 28.3 bits (60), Expect = 0.94 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +3 Query: 459 RSLATKDSKNELTHTHNPLSSRRIFSVGRVS 551 R+ ++ +KN L + NP+S++R+ S+ RV+ Sbjct: 355 RATSSWSTKNSLVFSSNPISNQRLSSLNRVA 385 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 28.3 bits (60), Expect = 0.94 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +2 Query: 251 FHYKNVYLPAVLEPWAWSHRLILVRAFYLGHDNSNDCKMQGYTSLRILSIH 403 F++ + V+EPW +S I+ + + NS+D T + + +H Sbjct: 1677 FNFAKSHWEPVIEPWTFSTTAIMKDGMHEVNINSDDIAQISLTPMMVTDVH 1727 >SPBC1861.01c |cnp3|SPBC56F2.13|CENP-C|Schizosaccharomyces pombe|chr 2|||Manual Length = 643 Score = 26.6 bits (56), Expect = 2.9 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 447 SSSNRSLATKDSKNELTHTHNPLSSRRIFSVGR-VSDPVVDSAKHYP 584 S NRSLA KN+ + PL I SV S+PVV + P Sbjct: 293 SMLNRSLANNSQKNKKRTPNKPLQESSINSVKEGESNPVVKRKRGRP 339 >SPAC56F8.16 |esc1||transcription factor Esc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 413 Score = 25.0 bits (52), Expect = 8.8 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 435 PVTPSSSNRSLATKDSKNE--LTHTHNPLSSRRIFSVGRVSDPVVD 566 P T + SN + +T S + LTH PLS+ F G+ P ++ Sbjct: 25 PTTSAPSNSASSTPYSPQQVPLTHNSYPLSTPSSFQHGQTRLPPIN 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,449,919 Number of Sequences: 5004 Number of extensions: 50690 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -