BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0090 (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39651-7|AAA80398.2| 494|Caenorhabditis elegans Hypothetical pr... 28 5.7 AC024755-8|AAF59636.2| 604|Caenorhabditis elegans Hypothetical ... 27 9.9 >U39651-7|AAA80398.2| 494|Caenorhabditis elegans Hypothetical protein ZK470.1 protein. Length = 494 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +1 Query: 436 VLSTLIPQINHFSHQHYIIISNR*SK*YRLIVPQLSTFNTFR*AVHAVRVPFTSFLPNTL 615 +L T+I + ++ ++ NR Y LI P + F +H + +PF SF+ L Sbjct: 305 ILMTVIFVFDCLTNGYWPFAENRKRLAYFLIAPLVFAFILMSSGIHYLILPFESFIYARL 364 Query: 616 ALV 624 AL+ Sbjct: 365 ALL 367 >AC024755-8|AAF59636.2| 604|Caenorhabditis elegans Hypothetical protein Y34B4A.8 protein. Length = 604 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 677 SVANSQFRPKEKAPPKKATSARVFGRKLVN 588 S++ FRPKEKAPP + + G L+N Sbjct: 446 SISPRSFRPKEKAPPPPSQTPSTSG-DLIN 474 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,285,490 Number of Sequences: 27780 Number of extensions: 274054 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -