BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0087 (568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 160 1e-41 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 8.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 160 bits (388), Expect = 1e-41 Identities = 76/78 (97%), Positives = 77/78 (98%) Frame = -1 Query: 568 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP*TMKIKIIAPPERKYSVW 389 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP TMKIKIIAPPE+KYSVW Sbjct: 56 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVW 115 Query: 388 IGGSILASLSTFQQMWIS 335 IGGSILASLSTFQQMWIS Sbjct: 116 IGGSILASLSTFQQMWIS 133 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 355 FQQMWISKQEYDESGPSIVHRK 290 F+Q W S Q Y + +V R+ Sbjct: 151 FRQNWASLQPYKKLSVEVVRRE 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,496 Number of Sequences: 438 Number of extensions: 3424 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -