BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0084 (510 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.60 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.60 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.4 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 5.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.4 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.6 bits (51), Expect = 0.60 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 147 NRLVNWSCTLKSAISDIE 200 N+ WS T+K+AIS+++ Sbjct: 388 NQRTEWSATVKAAISEVQ 405 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.6 bits (51), Expect = 0.60 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 147 NRLVNWSCTLKSAISDIE 200 N+ WS T+K+AIS+++ Sbjct: 426 NQRTEWSATVKAAISEVQ 443 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 388 ASLGWTATATSPSMVSTLVVATITSSSEPSTLYAK*TSTPNST 260 ASL T + + TIT+++ +T T+TPN+T Sbjct: 639 ASLSSTHSHPHEPGAPATTITTITTTTTTTTTTTTTTTTPNTT 681 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 179 LQRTGPVDQSVRTIDVSSVVQSYEG 105 + +TGP + TI V Q+YEG Sbjct: 53 VDQTGPTHAPIFTIAVQIDGQTYEG 77 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 5.6 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 355 GMWLWLS 375 GMW+WLS Sbjct: 412 GMWMWLS 418 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 53 PVVGRTDPPPP 21 PV G +PPPP Sbjct: 1852 PVSGSPEPPPP 1862 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 222 HGFQHTSSHY 231 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 222 HGFQHTSSHY 231 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 222 HGFQHTSSHY 231 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 222 HGFQHTSSHY 231 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 211 HGFQHTSSHY 220 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 350 HGFYSSSSHY 321 HGF +SSHY Sbjct: 222 HGFQHTSSHY 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,496 Number of Sequences: 438 Number of extensions: 2818 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -